fredag 31 juli 2015

Invandrare och trygghetssystemet

Vår trygghet ska garanteras av Polismyndigheten och Försvarsmakten och i dessa två funktioner måste det finnas ett oeftergivligt krav på kommunikationskompetens.

Fullständig förmåga att förstå och förmedla budskap under krishantering är naturligtvis ett grundkrav för anställning som polis och soldat.

Trots detta börjar nu båda myndigheterna falla undan för den politiska korrektheten och åthutningarna från diskrimineringsparagrafryttarna.


Klicka på texterna så blir de större

-
-


Nya vänstern och islam

Vänsterpartiet och Miljöpartiet har gått från att vara sekulära rörelser till att bli islams propagandamegafoner i Sverige.

Nu reagerar till och med de egna.

Klicka på texten och läs om den nya vänstern och islam.
Högerklicka och välj ny flik om du vill ha en bildlänk.

-

onsdag 29 juli 2015

Expressen och ubåten



Klicka på texten och läs om Expressens ubåtsjakt.
Högerklicka och välj ny flik om du vill ha en bildlänk.

Om duktighet



Klicka på texten och läs om misslyckade vänsterdebattörers avundsjuka reaktioner på säsongens bästa sommarprogram.

Högerklicka och välj ny flik om du vill ha en bildlänk.

Om Pisa



Klicka på texten så blir den större

tisdag 28 juli 2015

Dagens reflektion

Klicka på bilden så blir den större.
Högerklicka och välj ny flik så får du en bildwebblänk.

måndag 27 juli 2015

Kyrklig prioritering

Medan de övriga samfundens ledningar upprörs när kristna flyktingar trakasseras av muslimer i Sverige, verkar Svenska Kyrkans ledning vilja blunda, hålla för öronen och tiga.

Om situationen hade varit omvänd så att kristna hade trakasserat muslimer, garanterar jag att katastrofrubrikerna hade varit som åskmoln.

Nu när allahu akbar råder i ärkebiskopskansliet, är det viktigt med politiskt korrekt prioritering.
Klicka på texten så blir den större



Mera om Svenska Kyrkans prioriteringar här◄klicklänk
-

Sverigedemokraterna mot makten

Klicka på texten så blir den större
Sverigedemokraternas position i väljaropinionen beror inte på egna politiska prestationer utan på inkompetens och omvärldsförnekelse från de övriga riksdagspartierna.

Den fullständigt idiotiska migrationspolitik som riksdagen har skapat. leder till att de flesta som invandrar till Sverige får uppehållstillstånd utan krav på motprestation.

När samtidigt de offentliga utgifterna i staten, landstingen och kommunerna skärs ned samtidigt som migrationskostnaderna skenar, reagerar naturligtvis väljarna som ser sjukvården, skolan, polisen, försvaret och äldreomsorgen drabbas av nedskärningar.

Det största ansvaret för utvecklingen bär socialdemokraterna, miljöpartiet, moderaterna och centerpartiet.
-


söndag 26 juli 2015

Miljöpartiet och islam

Efter Maria Wetterstrands mandatperiod har det inte funnits en politiskt välorienterad miljöpartist i riksdagshuset och knappast innan heller.

Nu har vi blådårarna Romsom & Fridolin där med Kaplan & Ruwaida och en lång rad andra muppar i släptåg.
Klicka på texten så blir den större

-

-

lördag 25 juli 2015

Nyhetssvepet

Jag hade bestämt mig för att låta min självpåtagna åsiktscensur upphöra, men av strategiska skäl får den fortsätta en kort tid till. Därefter kommer det mera om en korrumperad journalist, en korrumperande miljöpartist och en desperat maktlysten centerpartist.

Här följer alltså några skärmdumpar från nyhetsflödet utan mina bifogade åsikter.

Om skillnaden mellan när en rappare och en fystränare kränker den politiskt korrekta journalistpöbeln.

Det handlar om frikort för det politiskt korrekta hatbudskapet!



Om hur S-märkta åklagare, advokater, sextorpeder och broderskapsledare går in i väggen.

Klicka på texten så blir den större. Högerklicka och välj ny flik så får du en webbadress till texten.




fortsättning följer..........

-

-

fredag 24 juli 2015

SFI om svennar

SFI - Svenska för invandrare borde lära ut seriösa fakta om Sverige och svenskar och den svenska normen.

I stället verkar de ägna sig åt ironiskt förlöjligande av Sverige och svenskar och den svenska normen.

Den här informationstalibanen har sannolikt flera lösa skruvar än fasta.

SFI-information ◄Klicklänk

Med sådant här studiematerial skapar SFI problem i stället för att lösa dem!



Klicka på bilderna så blir de större





Här följer några kommentarer till författarens recension av sin egen bok

98 kommentarer om “Gästbloggare Anders Westerberg: "En guidebok för dem som verkligen skulle behöva en.

De som flyttar hit."”

Varför kränker du mig? 
Att använda ordet svenne är precis lika kränkande att använda orden blatte, neger o s v. Det är rasistiskt och olagligt. Vad fasen är inte det du gör?
Jag blir så ledsen.
Jag älskar mitt land Sverige och varför kallar du det skitlandet?

Skrivet den juli 22, 2015 kl 9:54 av Mia Larsson
Ska du inte istället lära dom hur man anpassar sig i Sverige?? Förnedring å kränkning av oss svenskar är vad du håller på med!! Fy!

Skrivet den juli 22, 2015 kl 10:17 av Micke
Detta ser ju bara inte rätt ut.
Sjukt att du får göra någonting sådanthära!
Anders Westerberg är Svensk fientlig och RASIST.

detta kommer inte glömmas bort!!

Skrivet den juli 22, 2015 kl 10:30 av Victor Emanuélsson
Jag trodde först att denna boken inte fanns på riktigt när jag läste innehållet, men till min stora fasa ser jag att den faktiskt existerar och dessutom rekommenderas
som läromedel på SFI!!?

Som svensk känner jag mig djupt kränkt över hur vi svenskar och vårt land framställs. I hela boken omnämns vi som "Svennar" och Sverige kallas för ett "Skitland".

Är det såhär ni vill att invandrare ska lära sig om Sverige och svenskarna?

Jag blir både ledsen och arg över att en sådan här bok används som läromedel, det är skrämmande, minst sagt.
Skrivet den juli 22, 2015 kl 10:36 av Stolt Svensk
Så detta anses som "utbildningsmaterial" för SVA och SFI? Mycket underligt att kränkningar åt ena hållet är ok och "godkänt", medan åt andra hållet är det hysteriskt känsligt.
Detta var ett lågvattenmärke!

Skrivet den juli 22, 2015 kl 11:11 av Johan
Vad är tanken bakom den här boken, och vad tror du nyanlända får för syn av svenskar som du kallar "svennar"? 

om du har missat det så finns det en del kristna svenskar, även om de flesta är sekulära. Att vi skulle dyrka Ingvar Kamprad och hans lärljungar bokhyllorna istället, kanske du tycker är roligt, men det är bara förlöjligande enligt min mening. Många tycker att kyrkorna är fina och vi firar gärna gamla traditioner i dem.
Samerna är INTE Sveriges första folk, utan ett av norrlands urfolk.(http://sv.metapedia.org/wiki/Ursprungsfolk, http://www.popularhistoria.se/artiklar/nya-fynd-skriver-om-norrlands-forntid/)

..och ett utedass består inte av en plåthink och det vet du mycket väl om! Den bilden är otroligt kränkande, inser du inte det själv? Ska de nyanlända tycka att vi är äckliga kuffar, eller?

Och vadå "gillar att svara på personliga frågor och talar gärna om sex". Det beror väl på vem som frågar och i vilket sammanhang.

"Bara föräldrar får klaga på sina barn", så tycker väl ändå inte de flesta? Om ens barn gör något fel och en annan vuxen säger till skulle jag bli glad iaf!! 

Och du.. "Skitlandet Sverige"? Nädu, nu ska jag gå o prata sex med främlingar, skita i en hink, förneka historiska fynd och be lite till den helige Ingvar, så att allt blir bra igen... 
Tänk efter lite snälla! Du bidrar till att människor får jätteknäppa fördomar om svenskar, och kanske de tror att det är ok att kalla oss svennar, vilket många svenskar inte alls vill bli kallade.

Skrivet den juli 22, 2015 kl 11:12 av Anna
Du borde inte få skriva några böcker alls ! Det är osmakligt och hånar oss svenskar med dina ordval !

Skrivet den juli 22, 2015 kl 11:41 av Tony
Trodde först inte detta var sant. Men när jag sen fick det bevisat att denna boken mycket riktigt fanns och att den tom används som läromaterial för invandrare blev jag bestört. Vilken syn ska dessa få av oss? jag blir oerhört kränkt av denna boken och förbannad när du kallar Sverige skitland. Sen att kalla oss Svennar, i en ironisk och kränkande ton anser jag vara väldigt rasistiskt.

Skrivet den juli 22, 2015 kl 11:53 av Li Rasmusson
jag kräver att denna bok stoppas,den är rasistisk mot svenskar och definitivt inget lämpligt läromateriel.....å svennar? blattar+ vad är skillnaden i uttryck
Skrivet den juli 22, 2015 kl 12:06 av Lena Svensson
Tänk vilken fantastisk bok du hade kunnat skriva om Sverige & oss invånare. Istället väljer du att djupt kränka miljoner människor på flera fula och intoleranta sätt, samtidigt som du låter landets nya invånare sväva i en tro om att svenskar faktiskt är vad du påstår dem vara.
Inte undra på att det blir kulturkrockar när din bok används!
Inte undra på att antalet våldtäkter ökar då svenskar verkar vara intresserade av sex.
Det uttryck för svenskar du använder är ett djupt kränkande uttryck. Hur många har inte fått höra att de är "svennehoror".
Säga åt dig att skämmas går nog inte, det har du nog inte förmåga till.
Hoppas att du berättar och visar för någon i din närhet som har bättre verklighetsförankring och omdöme är nog att hoppas på.

Skrivet den juli 22, 2015 kl 12:14 av Íngrid
Vad i helvete, kan vara det absolut sämsta försök till att vara rolig på vår bekostnad jag någonsin sett. 

Snacka om att vara kontraproduktiv och föda fördomar.

Skrivet den juli 22, 2015 kl 12:29 av Erik wedlund
Du glömde skriva att svennar inte får säga negerkung för det kan kännas nedsättande och att endast en (som de ofta själva refererar till varandra) 'nigger' får använda ordet 'nigger' till en annan svart person, men att 'svenne' går bra eftersom en sådan tydligen är okränkbar!!
Varför inte istället förklara att vi lever i de lättkränktas tid och att det inte är speciellt snällt att lura de nyanlända till att använda ord som kommer göra dem impopulära.

Skrivet den juli 22, 2015 kl 12:30 av Thomas
alla asylanter från Arabländer kränker hela Sveriges land

Skrivet den juli 22, 2015 kl 13:14 av barbro williams
ÄR SVERIGE OCH SVENSKAR ETT SKÄMT???!!!!!
VERKLIGEN UPPRÖRANDE OCH BÖR STOPPAS OMEDELBART!
Detta SKAPAR RASISM!! SKÄMS!😡

Skrivet den juli 22, 2015 kl 13:41 av Cecilia A
Seriöst???
Författaren måste vara helt hjärndöd eller levt under en sten senaste decennierna... jag har inte sett 
något värre på bra länge. Undrar om någon pk reser sig
och går efter att sett detta.

SD kan tacka dig för att du just värvat röst till
dom. Nu får det fan ta mig vara nog!!!!

Skrivet den juli 22, 2015 kl 13:50 av Jannewella
Just nu sitter jag i shock och bara stirrar på sidan jag har läst. 
Jag själv har utvandrat till England, men kan lugnt säga att jag saknar mitt hemland. Jag läste på din blogg att du har rest mycket och har saknat en bok om det landet. Det i sig är det inget fel på, men kanske du har varit borta från Svergie lite för mycket? 
Med tanke på att vi svenskar är rasiter när vi firar lucia, med personer som klär ut sig till pepparkaksgubbar. Vi är också rasister när vi hissar svenska flaggan, vi är rasister när vi firar skolavslutning i kyrkan ( vilket är en gammal tradition). När jag tänker på det, så tror jag att det inte spelar någon roll vad vi gör, eftersom vi är racister. ( vilket är lögn) då kommer min fråga till dig: är det inte rasistiskt att kalla oss svennar, se oss be utanför Ikea, säga att vi inte säger vad vi röstar på etc.
Jag vet att svenskar inte sitter på bönemattor utanför Ikea varje söndag. 
Jag vet många människor som inte har några problem och säga vem eller vad de röstade om. 
Jag hade heller inga problem och säga vad jag tjänade, inte heller mina vänner, men om du som en okänd person frågade detta, så skulle det tas illa vid, men det tror jag att det gäller överallt i världen.
Snälla tänk om. Din bok kommer att göra mer skada än nytta.
Skrivet den juli 22, 2015 kl 13:59 av Marika
Brukar tåla det mesta, men detta är över gränsen med god marginal. Skulle vara intressant hur du tänkte egentligen? Är ditt ordval enbart för att provocera? Skäms tamefan!

Skrivet den juli 22, 2015 kl 14:05 av Toxine
Vilket bra sätt att kasta bort en unik chans på, en chans att ge nyanlända människor en rättvisade och positiv bild av Sverige. Du har istället valt att förlöjliga Sverige och svenskarna och framställa oss som ett folk man inte behöver visa respekt. Vem gynnar detta?!

Skrivet den juli 22, 2015 kl 14:09 av Sofie
Vad är detta för trivialt alster. Lustifikationer och förnedrande av svenskar är vidrigt. Den barnsliga tonen mot läsarna är endast förlöjligande. Detta kan inte vara sant att vi beskriver vårt land och medborgare på detta vis. Det är en skam och gränsar till landsförräderi. 

Det här tar jag bestämt avstånd från. Var stolt och stå för ditt land istället för att ta fegisens bakdörr - cynism. 

Skamligt.

Skrivet den juli 22, 2015 kl 14:16 av Andreas
Fy fan vilket hån mot sverige och svenskarna. Vi öppnar vårt land och plånböcker. ..och detta är vad dom får för uppfattning av oss ?? Du borde skämmas. Hur kan du tro att detta skulle förenkla itegrationen ? Detta skulle du straffas för.

Skrivet den juli 22, 2015 kl 14:22 av Susanne
Detta måste utan tvekan vara det sjukaste jag sett !!!

Skrivet den juli 22, 2015 kl 14:27 av Björn
Det var det värsta jag har läst, tacka fan för att alla utlänningar kallas oss svenne med mera. rena rasistiska påhoppen.
hoppas att någon anmäler dig för rasism, för det är inget annat

Skrivet den juli 22, 2015 kl 14:41 av kim
Är du dum i huvet?
Själkränkande jävla kräk. 
Varför inte använda neger blatte guling osv?
Skrivet den juli 22, 2015 kl 14:51 av Patrik
Jag antar att du är SD-anhängare?...för du har precis skaffat dem ännu fler anhängare.

Skrivet den juli 22, 2015 kl 14:58 av Mats
Jag känner mig kränkt och vi svenskar borde anmäla denna boken, tyvärr så kan en svensk inte anmäla för "hets mot folkgrupp"

Skrivet den juli 22, 2015 kl 15:04 av Niklas
Är detta ett skämt ? För om detta stämmer så är det det mest kränkande jag sett emot Svenska folket. Hur kan du ens med att skriva en sån här bok . Stämmer detta så kan du se dig själv som anmäld för hets mot folkgrupp . Ärligt talat detta är inte ett korrekt beteende. Fy skäms säger jag bara. Rasistiska påhopp mot hela Svenska folket. Svennar är inte ok att säga samma som Blatte mm.mm.mm ! Mvh Cihm

Skrivet den juli 22, 2015 kl 15:12 av Cihm
"Anders Westerbergs bok innehåller en del faktatexter men de flesta är humoristiska, en del 
med ironi andra med komiska överdrifter."

>>Vilken perfekt blandning!

När SFI väljer att använda en komisk bok med inslag av fakta, i utbildningssyfte.
Ni har privilegiet att utbilda Sveriges nya medborgare. Sättet ni nyttjar er av den makten, är en gryta av miss-information, lögner och förtal.
Låt skammen bita er, stå för den värdelösa ideologi ni kokar ihop och ta ansvar för det ni lär ut.

Som svensk kan jag inte mer än skämmas över den framtid som ni lär ut. 

För ansvar, över folks ageranden p.g.a er ideologi, det kommer ni aldrig att ta.

Skrivet den juli 22, 2015 kl 15:45 av Juli
Trodde inte heller detta var sant innan jag såg det, har fortfarande svårt att tro att detta inte är något slags skämt. I utgångspunkt att detta är sant: Jag är ledsen Westerberg med jag tycker du verkar vara en idiot. Du förstör både för oss infödda och för de som kommer hit, jag vill inte kallas för Svenne, jag tror inte alla invandrare\flyktingar från arabländerna vill kallas Abdullah och jag tror inte alla greker vill kallas Kostas och alla finnar för Pekka osv. Fulkommligt vansinnigt utförande, ett riktigt riktigt dåligt skitjobb, jag skämms att vi har sånt skräp i SFI undervisningen.

Skrivet den juli 22, 2015 kl 16:12 av Erik
Dina försökt att vara ironisk och "rolig" faller handlöst.
Det är förlöjligande och rasistiskt.

Be om ursäkt och skäms!

Skrivet den juli 22, 2015 kl 16:57 av Hilda
Hej Anders 

Jag har funderat fram och tillbaka under dagen på din bok. Din bok illustreras med nidbilder av svenskar, eller som du kallar det "svennar", din beskrivning av svenskar är full av fördomar , som jag förstår ska få oss att skratta igenkännande (?). Boken används av SFI för att lära dom som kommer hit vilka födomar dom ska ha om oss "svennar" (?). Jag försöker förstå ditt syfte Anders , men det blir helt svart, jag tänker om boken hade handlat om invandrare i förorten istället om den illustrerats med nidbilder om dom. Jag känner mig nästan stum , och det är första gången jag skriver till en författare, för detta förstår jag inte. "Värsta språket" hade finess, denna boken har inget. MVH Yvette

Skrivet den juli 22, 2015 kl 17:02 av yvette Jonsson
Du borde för fan skämmas över den bok du skapat, du hånar ett helt folk.

Skrivet den juli 22, 2015 kl 17:09 av Lars
vad är det för fel på dig ??? Rasistjävel

Skrivet den juli 22, 2015 kl 17:22 av Bengt Åslund
Värsta hatboken mot svenskar jag sett. Är det sådant flyktingarna ska lära sig om vårt land. Ta dina svenskfientliga kompisar och dra härifrån Du och Mona Muslim skulle passa bra ihop. Hon hatar ju också Svenskar
Blir spyfärdig när jag ser vad du skrivit.

Skrivet den juli 22, 2015 kl 17:28 av Ingvar
Bra jobbat, ett av det första nyanlända ska lära sig är att det är ok att använda ordet svenne som utan tvekan hittats på för att förlöjliga och kränka svenskar. Det underlättar säkert integrationen! I övrigt så är det säkert ingen lätt uppgift att försöka förklara hur svenskar är, en o annan klumpig förenkling är säkert oundviklig. Inget jag hänger upp mig på.. Har inte läst boken.. Men hoppas det står något om att yttrandefrihet och sekularitet står högt i kurs i Sverige!?

Skrivet den juli 22, 2015 kl 17:32 av Leino Svensson
Uselt. Kränker som sagt en hel nation. Pinsamt att ett förlag kan gå med på att trycka sån här smörja. Hoppas SFI lärare är vettiga nog att inte använda boken. Hoppas Anders själv inser att det han gjort är väldigt fel.

Skrivet den juli 22, 2015 kl 18:31 av John
Att detta används som undervisningsmaterial är ju katastrof då jag antar att detta ska vara en satirbok för nöjesläsning.
Men inget gör en förvånad i detta landet längre. Som Svensk börjar man faktiskt känna sig utanför i sitt eget land och då är nåt jävligt fel.

Skrivet den juli 22, 2015 kl 19:13 av Daniel
Boken cementerar fördomar om svenskar samt försöker visa att svenskar vare sig respekterar sitt land eller sig själva. Nedlåtande, arroganta uttryck för folket i fråga förmedlas på nästan varje sida medan generaliseringar och stereotyper bidrar till att håna svenskar. Ett helt utmärkt sätt att skapa vi och dom-känsla och att bidra till missförstånd och osämja.

Nej, det var inte roligt, Anders. Det var ett plumpt trakasseri av ett folk du uppenbart tycker väldigt illa om. Satir är satir. Detta är bara ett pinsamt magplask.

Skrivet den juli 22, 2015 kl 19:28 av Arona L.
Men jävlar va "lustigt".....idiot

Skrivet den juli 22, 2015 kl 19:29 av Anders
Detta får inte vara sant! Den boken måste bort!! Nu!

Skrivet den juli 22, 2015 kl 19:33 av Liselott
Detta är fruktansvärt.

Men Anders, vilka svenskar skriver du om? Fel att be i kyrkan, skriver du. Ja, svenska muslimer ber nog ytterst sällan i kyrkan. Anser du att du alltså beskrivit svenskar från Afrika, Syrien och Sydamerika? Eller skriver du bara om "ariska" svenskar? Ingår samer i så fall?

Kan du vara vänlig att specificera denna märkliga grupp "svennar" som uppenbart är precis likadana allihop.

Skrivet den juli 22, 2015 kl 19:41 av Annika
Helt stört att detta skulle vara en bok för någon som flyttar hit. Roligt? Nä inte för fem öre. 
Ger bara ett "vi och dem" samhälle. 
Denna boken är en skam. Anders må få ha sina åsikter om Sverige men att trycka upp dem i nyllet till någon som kommer hit som något slags läromedel eller ens göra en bok om det? Nä usch alltså. 
Och nä Svenskar kallar inte sig själva för "svennar" eller säger "det där var typiskt svennigt". 

Hatad av ett helt land, bra jobbat!
Synd du måste göra det så tydligt att du är rasist.

Skrivet den juli 22, 2015 kl 19:55 av Max
Det här var det mest kränkande jag läst på mycket länge. Det ger en snedvriden bild av oss svenskar för de nyinflyttade. Hur du Anders formulerar dig gör att de nyanlända kommer att se oss svenskar som mindre begåvade bonnarslen som de inte behöver visa någon som helst respekt för. Hur i hela friden tänkte du när du skrev detta alster? Detta gör segregationen ännu större, vi och dom. Du är i och med detta inte ett dugg bättre än rasister i mina ögon.

Skrivet den juli 22, 2015 kl 20:19 av Per von Carlsburg
Jag spyr över din bok! Att du inte skäms ditt självhatiska kryp. Gör oss en tjänst och avgå från samhället.

Skrivet den juli 22, 2015 kl 20:23 av Krille
Vidrigt att använda denna smörja i SFI undervisning. Många invandrare har redan en kränkande attityd gentemot svenskar, och denna bok förstärker deras fördomar. Äckligt!

Skrivet den juli 22, 2015 kl 20:48 av PA
Fantastiskt rolig och klockren!
Om den bör användas som läromedel låter jag vara osagt men i övrigt: hysteriskt rolig!

Skrivet den juli 22, 2015 kl 20:57 av Sanna
Detta är ju helt sjukt! Så fruktansvärt rasistiskt och vidrigt. Jag hoppas verkligen att man inte använder denna bok till SFI! Borde polisanmälas för hets mot folkgrupp!

Skrivet den juli 22, 2015 kl 21:12 av Johanna
Hade man skrivit så här om en annan folkgrupp än den svenska hade vi haft ett massmedialt ramaskri. Man hade vrålat ursinnigt om rasism, nazism och fascism; man hade hänvisat till rasistiska nidbilder och författaren hade tvingats till avbön och offentlig ursäkt med risk för en totalt grusad karriär.

Svenskföraktet, hyckleriet och dubbelmoralen i och med denna bok är fulländad och boken tycks vilja en enda sak -- att fostra genuin rasism. Jag undrar om jag som svensk kan åberopa "tolkningsföreträde"? ;)

Typisk vänsterpolitisk kommunistsmörja.

Skrivet den juli 22, 2015 kl 21:33 av Marcus
Vad är det för mening med att segregera änn mer i samhället? Kan (kanske) förstå att det är skrivet på skämt men isåfall ett skämt som kan dras sinsemellan när man är intregrerad i samhället. Att som nyanländ få lära sig att förakta folket som bor i det land där man skall skaffa sig en framtid är väl inte rätt väg att vandra? 
Skrivet den juli 22, 2015 kl 21:40 av Anders
Jag trodde att detta var ett skämt vid första blicken, för att sen se att det verkligen är en riktig bok.
Inte undra på att våra nysvenskar har bristande respekt för oss svenskar.

Skrivet den juli 22, 2015 kl 21:45 av Johan
Helt ok om du vill skriva skit. Men att mina skattepengar går till att köpa in detta och att någon som jag genom skattemedel betalar lön till tycker detta är värt pappret det är skrivet på gör mig rasande och gör att jag känner mig otroligt kränkt.

Skrivet den juli 22, 2015 kl 21:48 av Peter Nilsson
Jag finner inga ord!!

Skrivet den juli 22, 2015 kl 22:12 av Malin Hagman
Detta är kränkande i högsta grad. Ska vi svenskar skämmas över att vi är svenskar? Jag gör det nästan när jag läser hur du kränker ditt eget land. Fy så hemskt att läsa. Man blir ledsen och bedrövad. Hur tänker du ? Vad ger dig rätt att uttala dig för alla svenskar. Funderar allvarligt på att flytta från det här landet innan det är för sent.

Skrivet den juli 22, 2015 kl 22:30 av anita raab
Anders!
En sak ska du ha klart för dig och det är att denna boken är ett lågvattenmärke av sällan skådat slag i ALLA avseenden!
Sen NÄR blev skällsordet svenne ett normaliserat ord?
Samtidigt som skällsordet blatte?

Jag har ett förslag till dig;
Det är ju så inne nu att vi "svennar" ska förstå alla blattar och speciellt Islam och muslimer.

Visa att det är lite krut i dig och slå dig ihop med Alice Bah och stick ut hakan och skriv en lika ironiskt bok om "mussar" och Islam och vad som är norm för dem. 
Jag ser speciellt fram emot nidteckningen med moskén och tron islam.

Be svenska folket om ursäkt karl!
På dina bara knän!

Skrivet den juli 22, 2015 kl 22:38 av susanna svensson
Det här finner jag oerhört kränkande. Varför, varför nedvärdera ett helt samhälle och dess innevånare? detta är personligt och rankas i mina ögon som ÄREKRÄNKNING!

Skrivet den juli 22, 2015 kl 23:22 av Jonny bauman
Min erfarenhet av människor från andra kulturer är att ironi inte är deras starka sida (speciellt inte muhammedaner). Böcker som denna kommer bara öka missförstånden mellan nyanlända och etniska svenskar. Och för kännedom så anser jag "svenne" vara lika hemskt som "neger" eller "sandneger" och bemöts precis på samma sätt. Skriv det i boken, för läsarens säkerhet.

Skrivet den juli 23, 2015 kl 0:06 av Erik
Hej har du speciella problem med svenskar, Hatar du dem, eller är du obildad och vet överhuvud taget inget om den Svenska värde grunden" 

att ge ut i utbildnings syfte denna smörja är ofattbart du borde skämmas

MVH 
RL

Skrivet den juli 23, 2015 kl 0:57 av Roger Linsefors
Nu skäms jag för att vara en stolt svensk efter att ha läst din artikeln. Det oroar mej att din bok finns tillgänglig för alla. Dina tankar och snedvridna uppfattning av SVENSKARNA borde du behållt för dej själv.

Skrivet den juli 23, 2015 kl 2:16 av Anna
Anders du är verkligen smuts😡🔫
Att du bara får komma till tals👊🏻
Näää hoppas du och alla i din närhet får alla sjukdomar 😱😱😱spyr på din släkt

Skrivet den juli 23, 2015 kl 2:56 av Slavko rasic
Ditt jäkla rövhål har du inget vett i kroppen. Jag skäms över din okunnighet du är verkligen en jubel idiot. En okunnig flicka på tv4 blir förföljd av vänsterpacket för ett fel ord men du ska gå säker på våra gator? Glöm det! Må du och din familj bli nergrävda levande och hoppas flera generationer i din släkt få lida en plågsam död med de värsta sjukdomar som kan finnas.

Skrivet den juli 23, 2015 kl 3:15 av Magnus
Jag trodde knappt det var sant! En ironisk bok illustrerad som en barnbok till nyanlända vuxna människor! Och varför ordet svenne? Är det vi etniska svenskar? Det ordet får man ju inte använda, varför är det ok med det nedlåtande svenne? Var finns det mångkulturella? Sverige är inte bara etniska svenskar längre. Och att jämföra ett shoppingnöje med tillbedjan i kyrka eller moské kräver en del klarläggande av läraren. Jag tycker inte den ska användas, så dåliga är de sidor jag sett.

Skrivet den juli 23, 2015 kl 6:32 av lisbeth sundman
Helt sjukt att man har detta som läromaterial, ser det mer som en ironisk bok inget man ska lära sig om Sverige.,
Sjukt hoppas någon anmäler dig för hets mot folk

Skrivet den juli 23, 2015 kl 8:06 av christer
Måste säga att jag förstår alla upprörda här. Som Svensk log jag när jag läste boken och kan bara hålla med att mycket stämmer, men det är när jag som Svensk läser den. Denna bok är absolut inte passande i utbildningssyfte och ABSOLUT inte till våra nyanlända. Då blir boken ett hån och kränkande mot Svenskarna och Sverige. Har själv varit i sitsen att vara nykomling i ett land ( USA ). Hade jag då fått en bok som denna i min hand hade jag börjat undra och frågasatt om de drev med mig. Gör om och gör rätt. Ge dem en bok som är informativ och som dom har hjälp av, denna information är ingen hjälp för dem och sluta kalla oss SVENNAR!

Skrivet den juli 23, 2015 kl 8:08 av Pia Fröjd
Förstår inte hur de kunde godkänna denna bok ! Som
Kränker svenskarna och de står skit land!!! Va är de för fel på dig och de andra som godkänt detta? Ska de lärasig att inte ha respekt för svenskar?? Är det din syfte? Ist för skriva en bok om hur man uppför sig i ETt samhälle och respekterar varandras .att de har religionsfrihet o yttrandefrihet osv.menatt skriva svenskar inte är kristnA och går till kyrkan ist till Ikea vad är det för fel med dig? De här borde tas bort och nån vettig person borde skriva om en bok där de lär sig de viktiga om att bo här och respektera vår kultur,lAgar, normer !
Skrivet den juli 23, 2015 kl 8:36 av Natta
Om du istället för Svenne använder z-ordet eller n-ordet hade du aldrig fått boken utgiven pga rasism. Men tydligen är det okej att kränka Svenskar genom att kalla oss Svennar som dyrkar bokhyllor och skiter i hinkar på semestern. 

Boken är rasistisk och kränkande mot svenskar. Att den dessutom används som utbildningsmaterial är skrämmande. 

Förlaget och författaren bör be Svenskarna om ursäkt och dra in boken.

Skrivet den juli 23, 2015 kl 8:36 av charlotte
Du Anders! Det låter som om alla människor i Sverige ska uppfattas som män. Jag vill inte bli kallad Svenne, du får hitta på något nidnamn för kvinnor! Det kan du säkert, så mycket skit som du har i huvudet.Sen en fråga varför är du i Sverige?Att du inte tar och packar och flyttar till något land där du kan utbilda folket innan dom kommer hit? Så kanske dom tror att alla i Sverige är idioter och inte kommer hit! Så slipper dom bli besvikna. Man bara undrar hur ett förlag kan ge ut en bok som denna, kanske kan dom inte läsa!Skulle inte bli förvånad! Du kanske är ute efter att vi ska hata invandrarna för du ger dom inte en chans att integrera sig, efter den uppfattningen dom får efter att ha sett boken! AHA nu förstår DU är en rashatare fy på dig Anders skäms för dig. Tur att vi inte har så många sådana som du i Sverige!! Börja packa!!

Skrivet den juli 23, 2015 kl 8:56 av Christina Holmström
Skitlandet Sverige !! Skäms !!!

Skrivet den juli 23, 2015 kl 9:16 av Jenni
Jag kan knappt tro att denna bok har fått bli publicerad. Den är både kränkande och infam mot svenskar och ett direkt hån mot Sverige. Snacka om att generalisera svenskar och idiotförklara svenskar. Tänk tanken att boken "så här fungerar en blatte i Sverige" hade tryckts... Verkar helt klart att ingen får diskrimineras i Sverige med undantag om du är svensk då är det givetvis legitimt.
Inte konstigt att SD vinner röster på saker som detta! Idiot!

Skrivet den juli 23, 2015 kl 9:19 av Peter
Om du var Magnus Betnér på scen och hade med dig denna bok hade jag skrattat, för detta är inget annat än ren och skär satir!

Att detta skräp används i utbildningssyfte för nyanlända svenskar är rent ut sagt groteskt! Du förnedrar hela svenska folket, du försämrar Segreringen och jag antar att du tar betalt för det också!?

Somliga har inte vett att skämmas ens, inte sant?
Åh vad jag önskar dig bort till fjärran öster, där hade du blivit behandlad därefter!

Vad tycker du? Ska jag ge min 7-åring din bok och be honom läsa den för det är den han är/ska vara!? Den borde kanske delas ut till alla skolor i Sverige så Svennen får en uppfattning om vad som förväntas av hen när den stöter på en nyanländ!?

Du framhäver oss som några jävla cirkus-objekt, en manual över hur vi som människor fungerar, du tycker kanske att du borde då Nobel-priset för detta? Jag vet då iallafall INGEN annan som har kommit fram med en generaliserande manual för hur ett helt lands population fungerar!

Ditt fantastiska kräk, tänk att man kan få en chans att nå ut till alla nyanlända och faktiskt få möjligheten att hjälpa dom att förstå det svenska samhället och detta är vad du skapar, fantastiskt urbota idiotiskt!

Hela du verkar vara hela SAOLs negativa ord i superlativ, jag skulle kunna skriva en hel bok till dig, men jag nöjer mig med detta och en anmälan till DO, får väl se om denna svennen fungerar enligt din produktbeskrivning!!!!!!!!!!!
Skrivet den juli 23, 2015 kl 9:29 av Regina
Jävla tomhylsa till "författare"! Jubelidiot!!!

Skrivet den juli 23, 2015 kl 9:52 av elge
Så kränkande detta var...Här vill ni att vi ska anpassa oss till olika kulturer o så läser man DETTA O BLIR KALLAD FÖR svenne....NÄ STOPPA DENNA BOKEN O GÖR DET NU....FÖR DET ÄR JU VERKLIGEN ETT HÅN MOT OSS SOM BOR HÄR O FÅR AACCEPTERA allt skit som kommer hit...

Skrivet den juli 23, 2015 kl 10:04 av Rulltårtan
Att du inte skäms, du skitar ner ditt eget land och dina landsmän. Att förlaget ens gått med på att trycka denna smörja, är för mig en gåta. Jag är ingen svenne, jag är en stolt svensk som inte bor i ett skitland utan i ett vackert land. Hade detta varit USA, så hade du och förlaget haft en stämning på er för förtal, hets mot folkgrupp och rasism av ett helt land och deras invånare. Att sedan denna bok ingår som undervisning på SFI är ett skämt. 
Till sist vill jag bara säga att jag ber lika lite till Ingvar Kamprad och IKEA, som jag ber till Svenska kyrkan så att ens antyda det är ytterligare ett övertramp på mig och alla andra som har sin tro. 
//Gunilla

Skrivet den juli 23, 2015 kl 10:05 av Gunilla Olsson
Bedrövligt! Var inte poängen att hjälpa invandrare att förstå svenskarna? Säger bara stackars invandrare, de får inte en ärlig chans att förstå. Om det som står i boken symboliserar en typisk svensk så är jag inte svensk, kommer heller aldrig bli. Det som används som läromedel ska bygga på fakta, inte på en författares egna skruvade vinklingar! Detta skapar riktiga kulturkrockar = dåld rasism. / Karin

Skrivet den juli 23, 2015 kl 11:14 av Karin mileteg
Hur ska en person som är ny i landet och håller på att lära sig språket kunna urskilja vad i denna bok som är seriöst menat, vad som ska föreställa ironi och vad som är menat som ett skämt? Tycker det mesta i boken (inkl. det flitiga användandet av orden "Svenne" och "skitland" känns extremt oseriöst! Hoppas SFI-lärarna har tillräckligt omdöme att INTE använda denna bok.

Skrivet den juli 23, 2015 kl 12:13 av Cajsa
Du borde skämmas! Det där är en modernare form av landsföräderi! 
Men med dagens invandring, så kommer den bli en dtorsäljare. 
Men hur ska alla nyanlända lära sig vad som är rätt och fel på riktigt? 
Idiot!
Skrivet den juli 23, 2015 kl 12:24 av jocke
Ta det här inte så allvarligt, gubben skämtar ju bara!

Skrivet den juli 23, 2015 kl 12:41 av Leif
Grattis till ditt bidrag i floran av publicerat material som ger invandrare en förvriden bild av svenskar!

Skrivet den juli 23, 2015 kl 13:23 av Germund Andersson
Hur skall man kunna bli respekterad av nyanlända när denna bok visar att vi inte respekterar oss själv?! 

//Staffan

Skrivet den juli 23, 2015 kl 13:26 av Staffan Aronsohn
Vad är det man inte ska ta allvarligt Leif?

Är hela SFI ett skämt eller vad menar du? Sedan när är undervisning ett skämt? Nog för att Pisa uppvisade urdåliga resultat men inte ens i vår grundskola skämtar man väl sig igenom kurser?

Eller har jag missat något!?

Svenska skattebetalare står för kostnaden av SFI - utbildning, ersättning till de nyanlända, utbildarnas lön samt skolmaterialet ( inkluderat denna jävla "bok" ) det är klart som fan att man inte skämtar bort skattemedel som kunde gått till vår urkassa grundskola, våra obemannade äldreboenden och vårdinrättningar samt landets gigantiska statsskuld!

Men sitt du där och skratta Leif och njut av det humoristiska i det hela. Hoppas du skrattar lika mycket den dagen hela landet går i kånken, då kan du skratta och se dig i månen efter både välfärd, vård, utbildning och pension!

Skrivet den juli 23, 2015 kl 13:33 av Regina
Att du inte skäms.
Förlöjliga ditt folk och land.
Jag blir kränkt av att vi kallas svennar det är lika förnedrande som nigger svartskalle blatte etc
Hur ska utlänningar som kommer från länder där myndigheter och myndighetspersoner är respektingivande och något man inte driver med förstå att respektera oss etniska svenskar och våra seder och bruk
Skäms på dig

Skrivet den juli 23, 2015 kl 13:45 av Kristina borg
Båda mina föräldrar är invandrare, själv född i Sverige och är uppväxt med 2 olika kulturer och språk. Trodde först detta var ett dåligt skämt men icke. Denna boken är något av det mest kränkande mot Sverige och svenskar jag någonsin läst. Förstår inte hur du tänker? Snälla förklara för mig! Fortsätter det såhär så kommer man ju snart få be om ursäkt för att man är "Svensk". Tror inte något annat land i hela världen skulle tillåta en sådan bok som förlöjligar sin egen kultur.

Skrivet den juli 23, 2015 kl 15:29 av Patrik
Herregud....Du är ju inte frisk på en fläck. Fööresten varför bor du i detta skitlandet???

Skrivet den juli 23, 2015 kl 15:30 av Thomas Axelsson
Jag har nog aldrig tagit så illa vid som över detta du har skrivit Anders Westerberg. Du är har förminskat och kränkt hela min familj och det svenska folket. Jag saknar ord för dig och vad du har gjort. Jag förstår inte vad du vill åstadkomma med att idiotförklara ditt egna lands invånare genom att måla upp en sådan bild. Jag hoppas bara att karma hinner ifatt dig någon dag din rasist.

Skrivet den juli 23, 2015 kl 16:05 av Jesper
Jag är inte lätt kränkt, men att bli kallad svenne får taggarna att skjuta ut. Otroligt dåligt skriven bok som sprider en massa dåliga fördomar. Att denna används i undervisning är ett riktigt lågvatten.

Skrivet den juli 23, 2015 kl 17:09 av Caroline
Jag blir ledsen och bedrövad när jag läser texten dom sprids om oss svenskar bland nyanlända. Detta bidrar definitivt inte till en fungerande integration. Dessutom känner jag mig kränkt och sårad.

Skrivet den juli 23, 2015 kl 20:10 av Boel Sjödin
Din text kränker o nervärderar och bidrar till att man ser Sverige o Svenskarna som dåliga mindre vetande inskränkta människor ..se till att nyanlända får lära sig våra seder o bruk och lagar o förorningar men framförallt svenska språket o inte nån blattesvenska ..svenne ..nä fy fan skam för detta .

Skrivet den juli 23, 2015 kl 20:27 av Tobbe
Länge sedan man blev så förbannad.
Är du helt tappad människa?
Borde bindas fast på torget så folk som går förbi får spotta på dig.

Skrivet den juli 23, 2015 kl 20:57 av Håkan
Man borde ta PENNAN IFRÅN DIG!!!!

Skrivet den juli 23, 2015 kl 21:36 av André
Jag tror inte mina ögon. Som lärare blir jag helt stum. Finner inga ord för hur idiotiskt detta är. Snacka om stolpe ut i ditt försök att vara humoristisk. Fy fan rätt ut sagt. Dra in denna skitbok omedelbart!

Skrivet den juli 23, 2015 kl 22:10 av Alexander Widerström
Du som har skrivit detta verkar ha grava problem. Är
det på detta sätt som du beskriver svensken ? Förnedrande är ordet ! 
Skriver på ett nedlåtande sätt om de människor som har byggt upp detta land och sen skall bli hånade på detta sätt. Klart ingen visar respekt för svensken om det första som de får läsa är att man inte heller skall höra det,
Kan bara säga att ta och gör om dessa böcker omgående och du som gjort detta borde avsäga dig uppdraget och be om utsökt till det svenska folket.
:(
Skrivet den juli 23, 2015 kl 22:19 av Martin H
Du skojar med oss va? 

Hur fan tänkte du nu?

Skrivet den juli 23, 2015 kl 22:41 av David
Hej Anders.
Angående din bok ”Typiskt svenskt” har jag några funderingar.
Enligt ”Läroplan för vuxenutbildningen 2012”, som grundar sig på Skollagen, går det att läsa följande under rubriken Uppdrag och värdegrund; 

”Vuxenutbildningen ska främja förståelse för andra människor och förmåga till inlevelse. Ingen ska inom vuxenutbildningen utsättas för diskriminering som har samband med kön, etnisk tillhörighet, religion eller annan trosuppfattning,
könsöverskridande identitet eller uttryck, sexuell läggning, ålder eller funktionsnedsättning eller för annan kränkande behandling. Alla tendenser till
diskriminering eller kränkande behandling ska aktivt motverkas.”
Det står även under rubriken ”Saklighet och allsidighet” att;
Undervisningen ska vara saklig och allsidig. När värderingar redovisas ska det alltid klart framgå vem det är som står för dem. Alla som verkar inom vuxenutbildningen ska hävda de grundläggande värden som anges i skollagen och i denna läroplan och klart ta avstånd från det som strider mot dem.”

Jag hoppas verkligen att denna bok inte används på riktigt. Det borde i så fall finnas tillräckligt underlag för att anmäla detta vidare.
Med vänlig hälsning Lotta
Skrivet den juli 23, 2015 kl 22:47 av Lotta
Hur är en människa som du funtad.
Här jobbar skolan med värdegrunder, för alla elever.
dit sätt att leverera ett tryggare samhälle är att likställas med terrorism.
allt jobb som människor lägger ber för utveckling och intigration har fullständigt raserats.
man blir så lessen och uppgiven när man läser detta.
Så hur tänker du? ???????
Sover du bra? 

Skrivet den juli 23, 2015 kl 22:55 av Kjell nylander
Anders du är en stor fjant, du får fan sluta och tycka saker som kränker mig som svensk. Flytta dina pinaler till någon annan världsdel. Lite respekt år du fanimej skaffa dig för Sverige och svenskarna och jag menar svenskarna inga bidragsturister.

Skrivet den juli 23, 2015 kl 23:12 av Björn
Svennar gillar att ha ledig på sommar, minst 5 veckor, för att det knappt går att leva i sverige större delen av året? 

Och sen fortsätter det i samma visa med helt bisarra tolkningar och överdrifter.

Jag tycker din bok sänder ut helt fel signaler och ger ett oerhört dåligt intryck av landet Sverige och dess befolkning.

Skrivet den juli 24, 2015 kl 0:28 av Per
Helt djävla sjukt😠 man får inte säga neger men det går bra att säga djävla svenne 😠😠😠

Skrivet den juli 24, 2015 kl 1:25 av Jakob
Är det bara jag som ser humorn i boken?

Skrivet den juli 24, 2015 kl 6:09 av nettan
Nejdå Nettan, jag ser också humorn och ironin. Men på PK-vis kan du ju pröva att byta ut ordet Svenne mot valfritt nedsättande ord om invandrare. Är det fortfarande humor då? Klart det är. Man kanske kan göra en version för Svennar ute i landet där man beskriver hur alla bla***r och zig****e gärna roffar åt sig och skiter i att stå i kö och gärna rånar dom äldre i byn. För det vet vi ju att alla invandrare gör, eller hur? Då kan det ju vara bra för svennar ute i landet att kunna förbereda sig på denna faktafyllda ironi om våra nya medborgare. Eller tänker jag fel nu?

Skrivet den juli 24, 2015 kl 6:28 av Pär
Jag känner mig verkligen kränkt över att kallas "Svenne". Och alla andra nedsättande saker du nämner om Sverige och svenskar gör mig förbannad rent ut sagt. Att man får lov att använda denna typ av smörja som undervisningmateriel är ofattbart!

Skrivet den juli 24, 2015 kl 9:07 av Lars


  1. På en gång nedsättande och generaliserad syn på svenskar. Hur skall man kunna se detta som humor när man kommer från kulturer där det inte finns någon "what so ever" distans till den egna kulturen utan en stor allvarlighet gällande egna värden. Att du har rest jorden runt har jag svårt att ta till mej då du verkar ha mycket dålig kännedom om hur man tänker inom andra kulturer. Är Svenne ett bättre ord än Blatte tycker du? Teckningen där en Svenne ligger i böneställning framför IKEA är riktigt obehaglig tycker jag. Måste även ses som kränkande för en muslim. Boken bör anmälas till diskrimineringsombudsmannen.
    Skrivet den juli 24, 2015 kl 10:02 av anna dalsjö

  2. Tråkigt ordval, svennar.
    Skrivet den juli 24, 2015 kl 10:22 av Dag sandberg

  3. Dåligt omdöme är bara förnamnet. Pinsamt, beklagligt och sorgligt.
    Skrivet den juli 24, 2015 kl 10:23 av Lisa

  4. Nu börjar jag verkligen inse varifrån våra invandrare får "luft" ifrån. Varför skulle vi (svenskar) acceptera all skit? Vilket förlag har givit ut detta material?? Är de inte läskunniga, eller är de invandrare allihop? Sådant här material ska absolut inte användas i undervisning!!!! Författare har ju möjlighet att ta sig vissa friheter, men stat och kommun FÅR INTE ACCEPTERA materialet i undervisningen. Jag kräver, som svensk, att slippa bli kränkt!!!! Vi tar emot människor, som uppger sig vara i nöd. Sedan visar det sig, med all önskvärd tydlighet, att så inte är fallet i väldigt många fall. För övrigt har vi ministrar i vårt land, som slickar våra invandrare "både här och där", vilket är minst sagt osmakligt. Mona Sahlin har en dotter med en "ickesvensk", så hon är väl litet "part i målet" och tänker väl på husfriden kanske. Men, oavsett vad, så behöver våra invandrare lära sig att "man biter inte den han som föder dig"! Gäller i detta fall svenska folket, som öppnat sitt land för dig. Jag förväntar mig litet större respekt för detta än att bli kränkt och "spottad" på!! TOTALFÖRBUD FÖR DENNA BOK ÄR FÖRSTA STEGET. Sedan måste vi återta vårt eget land och inte skänka bort allt, inklusive vår själ!
    Skrivet den juli 24, 2015 kl 10:57 av Sigyn Eriksson

  5. Är ni helt dumma i huvudet???
    Kallar någon invandrare mej "Svenne" kommer jag kalla dem "Svarting" borde vara samma??
    Kan du inte lämna landet och ta dina böcker med dej?
    Skrivet den juli 24, 2015 kl 11:05 av Micce

  6. Hm, när jag läste denna bok trodde jag att det var ett enda stort skämt!! Men herregud börjar det inte gå lite för långt nu med att förlöjliga oss svenskar, som är stolta över vårt land och våra traditioner. Det är inte så konstigt att alla invandrare tycker att de kan göra som de vill mot oss(detta är sagt av en invandrare) för vi tillåter det själva bl.a. då genom sådana här "böcker".
    Skrivet den juli 24, 2015 kl 12:02 av Eva

  7. Du ska vara glad för att vi "Svennar" är civiliserade och inte som muslimerna annars hade du stått under dödshot nu!
    Skrivet den juli 24, 2015 kl 12:07 av Vivi

  8. Jag inser att boken är skriven av en person eller flera personer som gillar att sprida hat. De vill öka känslan av 'vi och dom'. Jag anser att författaren bör straffas för hatbrott och sedan utvisas oavsett var de kommer ifrån. Hade man skrivit en bok med ord som 'blattar' eller 'sand negrar' så hade det aldrig getts ut. Hur kan detta ges ut? Det är fel. Visst får man uttala sig fritt men det finns ingen anledning varför man skall ge boken till nyanlända. Boken är bullshit och de som sprider sådant bullshit eller stödjer sådant är sjuka individer som ogillar fina gamla traditioner. Fuck off säger jag. Svenskarna måste samla sig och våga säga ifrån. Det är inget fel i att vara lite patriotisk eller att vara stolt över sitt land. Är det konstigt att folk röstar som de gör? Nej. Det är bara ett hemligt sätt att vara patriot när man inte annars vågar.
    Skrivet den juli 24, 2015 kl 12:26 av Frank Proner

  9. Detta är utan tvekan det sjukste jag läst pch sett...
    Det är bara ännu ett steg vidare att öka segregering och hat i vårt samhälle.
    Kul att du väljer att kränka ett folkslag också din sopa! Jag tycker (och lever efter) att INGEN ska kränkas eller få ta emot rasistiska glåpord, men ja... Så fel man kan ha!
    Sådana människor som du skapar rasism.
    Skrivet den juli 24, 2015 kl 12:41 av Kalle

  10. Du är körd när som
    Skrivet den juli 24, 2015 kl 12:59 av Kalle wallander

  11. Jag har tagit del av undervisnings material som används i samband med SFI och upplever det oerhört kränkande med att man lär nyanlända svenskar som ska vara del av vårt sammhälle att se svenskar som något fult. Har undervisat ungdommar från alla delar av vårt avlånga land så väl som med alla bakgrunder och kan vittna om att segregeringen är ett stort problem. Bla är ordet svenne använt som glåp ord för de som får sin vardag och liv stt fungera i sverige. De som får bra betyg, bra jobb, svenska vänner, är. Med och firar så väl svenska som sina egna högtider. Ordet och epiteten svenne gör att många av utländska föräldrar eller härkomst är rädda för att hamna emellan aldrig ok med oss "svenskar" och utfrysna av den grupp som glorifierar utsatthet eller utanförskap och identifierar med Getto!!!
    Ni får ändra detta!! Detta ord är en trojansk häst för det som leder till livslång utanförskap och ett sammhäle med ökade problem pga sociala slitningar. I sin värsta form så lämnad män utanför och blir lätt offer för fundamentalistiska influenser!!! Skriv om gör rätt dra in upplagan!! Med vänlig hälsning, Kishti Tomita Toure
    Skrivet den juli 24, 2015 kl 13:53 av Kishti Tomita Toure

  12. När jag såg inlägget på FB så trodde jag att det var en dålig fejk skapad av något rasisttroll. Nu ser jag att nej då, den här boken är på "riktigt". Jag skäms å dina vägnar inför alla som skall behöva genomlida det här. Stereotypt, förlöjligande, och inte alls ägnat åt att göra en bra integration. Nåja, SD blir väl glada, de gynnas av sånt här dravel.
    Skrivet den juli 24, 2015 kl 14:11 av Anders

  13. Jag känner mig oerhört kränkt av innehållet och det frekventa bruket av ordet "svenne" i denna "lärobok". Det är en skandal att en bok som denna publiceras av en myndighet som bekostas av skattepengar. Boken är dessutom en skymf mot alla oss som bedriver seriös undervisning och kunskapsförmedling. Det är läge att ansvariga uttalar sig.
    Skrivet den juli 24, 2015 kl 14:49 av Maria

  14. Skäms för att vara svensk just nu. Vad är det för fjanterier, lögner
    och fördomar du anser att människor ska tro om svenskarna?
    Den dagen jag får säga neger, blatte, spagge, kolsäck och
    arab och anses rolig och inte rasistisk, så får du lov att kalla mig
    svenne i ett skitland! Fram tills dess hoppas jag att alla dessa böcker
    bränns på bål.Som bränsle kan vi använda lite blad ur koranen och
    några burkor...roligt va?
    Skrivet den juli 24, 2015 kl 14:59 av Camilla Persson

  15. Hej!

    Mitt namn är Svenne Gustafsson.

    Jag undrar bara varför folk blir kränkta över att bli kallade för Svenne? Det är en svenskt fint namn, det tyckte iallafall min mor som valde att döpa mig till det.

    Några utav er jämförde Svenne med Blatte.
    Det finns 100st andra svenskar som heter Svenne, det finns 0st invånare i Sverige som heter Blatte.

    Föll polletten ned eller är ni bara korkade?
    Skrivet den juli 24, 2015 kl 15:41 av Svenne Gustaffson

  16. Hej Svenne!
    Det måste vara du som är korkad eftersom du inte har förstått att "Svenne" är ett rasistisk, nedlåtande och kränkande öknamn som invandrare använder sig av när de benämner Sveriges urbefolkning.
    Dessutom så finns det 110 män i Sverige med namnet Svenne.
    Vivi
    Skrivet den juli 24, 2015 kl 15:58 av Vivi

  17. Hej Svenne Gustafsson. Eller är det Svenne Gustaffson? Om du ska trolla får du göra det liiiiite bättre än såhär.

    Menar du att författaren skriver om just dessa "Svenne"? För han lär knappast skriva om dig som bara sitter och tror att du hade en poäng med ett fejkat namn. Eller tror du att författaren tror att alla svenskar heter just Svenne?

    Den enda som är riktigt korkad här är du som pratar om polletter när du inte ens fattar budskapet i boken. Jag förstår att du inte använder ditt riktiga namn så att alla får se hur genuint korkad du är.
    Skrivet den juli 24, 2015 kl 16:05 av Pär

  18. Du äcklar mig med dit självhat
    Skrivet den juli 24, 2015 kl 16:07 av Kristian Nilsson

  19. Oavsett om du heter Gustaffson eller Gustafsson så var det klockrent!

    Synd att du slant på tangentbordet bara så att fokuset lades på den bagatellen istället!
    Skrivet den juli 24, 2015 kl 16:12 av Mårten

  20. Hej

    jag är både Svennefierad invandrare och delvis Hollywoodfierad (person som kollar, lyssnar och halvt järntvättas av Am media och underhållning). Jag har dessutom bott flera år i miljonprogrammen.


    Enligt min mening så kan ingen bli kränkt enligt följande kodex:
    1 en svart får kalla en annan för neger.
    2 blattar kallar varandra för blatte
    3 "svenskar" kallar varandra för svennar

    Jag undrar varför så kallade "ursprungssvenskar" blir kränkta över att bli kallade för Svennar av andra svenskar?

    Dessutom är Svennarna en viktig del av svensk historia (wiki Svearike)så om något så borde alla ni kränkta där ute byta ut er kränkthet mot stolthet och skapa förändring hos er själva från grunden istället för att bära offerkoffta. Jag känner massa sköna Svennar!

    Peace
    Skrivet den juli 24, 2015 kl 16:21 av Tim Fedorov

  21. Att kalla svenskarna för "svennar" är en otrolig skymf mot alla oss Svenskar. Denna bok hade aldrig fått gå i tryck om man skrev neger. Ta ert förstånd och dra in boken omedelbart. Jag hoppas att vi svenskar aldrig accepterar detta
    Skrivet den juli 24, 2015 kl 17:53 av Peter

  22. Varför är detta en bok som gör narr av etniska svenskar? Vi varken tillber IKEA eller vill bli kallade svennar, lika lite som att invandrare vill bli kallade blattar eller generaliserade som muslimska fanatiker.

    Hur kan man teckna/skriva en sådan här bok och kunna sova gott på nätterna? Varför hatar man sitt eget folk?

    Lika lite som det är ok att skämta om svarta människor, muslimer eller annat, är det att skämta om svenskar.

    SKÄRPNING!!
    Skrivet den juli 24, 2015 kl 17:57 av Kalle

  23. Känns som boken är dåligt genomtänkt. Tanken är väl att vara rolig men den fungerar dåligt som undervisning av nyanlända vilka antagligen blir mer förvirrade och tror att man skämtar med dem.
    En upplysande bok om hur vårat samhälle fungerar med lagar och värderingar hade varit önskvärt. Allt för många tror att man endast har rättigheter och inga skyldigheter när man blir svensk medborgare.
    Skrivet den juli 24, 2015 kl 21:43 av Marie

  24. Hej!
    Kommentarsfältet ger en mycket otäckare bild av svennarna än boken.
    Skrivet den juli 24, 2015 kl 21:57 av Anders

  25. Jag är helt chockad ! Hur kan din bok få användas som läromaterial på SFI??? Åh en bli publicerad ?? Att du inte skäms ..
    Kan det bli mer kränkande åh förlöjligande av oss svenskar??
    Nä knappast det här var lågt .
    Vad ska nyanländas syn på oss bli ?
    Jag är mållös vad fan är Sverige på väg ..
    Skrivet den juli 24, 2015 kl 21:59 av Karolin

  26. Mårten, visst var det synd att hen slant på tangentbordet. Det förtog liksom hela trollningen.
    Är det inte underbart med ärliga människor?
    Fast visst har hen en poäng. Vi kanske skulle börja
    alla invandrare för Mohammed. Kvinnor som män, oavsett varifrån dom kommer. Det skulle säkert uppskattas.

    Och nej, det ovan var ironi. Det är bäst att jag skriver ut det i klartext eftersom du tyckte att "Svenne Gussens" inlägg var klockrent.
    Skrivet den juli 24, 2015 kl 23:23 av Pär

  27. Jag är mållös. Utbildningsmaterial? Vi måste vara den enda nationen i världen som avsiktligt underminerar vår egen identitet och kultur till pajasnivå!
    Skrivet den juli 24, 2015 kl 23:33 av Fredrik

  28. Hell mållös. Trode verkligen utbildningsmaterialet hade någon form av krav på sig. Tydligen är fallet inte så.
    Skrivet den juli 25, 2015 kl 1:16 av David

  29. Trodde det var ett dåligt skämt men tydligen är den här boken på riktigt. Jag känner inte igen mig i dina beskrivningar av oss svenskar. Känner mig riktigt ledsen att nysvenskar ska få de här fördomarna serverade när de ska börja lära sig språket. Till förlaget: sluta ge ut den här smörjan om ni vill bli betraktade som seriösa! Till SFI: blir arg när jag tänker på att ni anväder våra skattepengar till att sprida en författares fördomar!
    Skrivet den juli 25, 2015 kl 7:42 av Daniel

  30. Detta är ju oerhört kränkande mot oss svenskar!
    Ett dåligt skämt.
    Om någon som kommer ny till detta land läser detta förstår jag om de får svårt att anpassa sig till vårat samhälle och heller inte vill anpassa sig!

    Måste vara en riktig tomte som skrivit detta.
    Skrivet den juli 25, 2015 kl 7:51 av Hampus

  31. Hur tänker du att motsättningarna ska minska när du är hånfull och nedlåtande mot svenskar?
    Om jag skriver en bok om hur blatten är så är jag rasist men svenskar kan man säga vad man vill om?
    Försöker du vinna politiska poäng med boken eller förstår du bara inte bättre?
    Skrivet den juli 25, 2015 kl 8:17 av Sandra

  32. Hoppas verkligen inte det är så låg klass på det undervisningsmaterial som SFI använder.
    Skrivet den juli 25, 2015 kl 9:41 av Carolin

  33. Jag är bestört och förbluffad. Den här boken om svenskar är en enskild människas högst privata åsikter. Den visar ingen respekt för det som är Sverige och för dess invånare. Nivån är mycket låg. Den platsar inte som kursbok.Hur kunde man från Sfi håll godkänna denna som kursbok och se till att mata våra nyinflyttade med dessa absolut mycket låga och väldigt subjektiva omdömen om det land de flyttar till? Sverige och svenskarna förtjänar mycket bättre än det här.
    Skrivet den juli 25, 2015 kl 9:44 av Seija Visuri

  34. Det är förlöjligande och fel.
    Jag tycker att du ska be om ursäkt och skämmas.
    Skrivet den juli 25, 2015 kl 10:14 av Elin
  1. Haha! Rolig läsning. Nickar igenkännande och ler. Synd bara att boken inte tog upp svenskens beteendet i hissen. Den här boken är inte mer kränkande för svensken än vad Homer Simpson är för amerikanner!
    Skrivet den juli 25, 2015 kl 12:13 av Charlie**

  2. Det här är inte roligt...Inte någonstans. Vad ville du uppnå med det här?
    Skrivet den juli 25, 2015 kl 12:59 av M

  3. Fritt fram med negerboll igen och dem kan ju sätta tillbaka den svarta dockan i Kalle Ankas julafton igen.
    Och sluta förtrycka Svenskar.
    Skrivet den juli 25, 2015 kl 13:03 av Daniel

  4. Tycker ni verkligen att detta är bästa sättet att lyfta fram Sverige? Känns olustigt att vara Svensk!
    Skrivet den juli 25, 2015 kl 13:32 av Michael

  5. Fy skäms på REN SVENSKA för ditt rasistiska skräp som du tyvärr fått distributera i tryckt form. Bedrövligt gjort att nervärdera ett land och dess befolkning, Du har vad jag vet inte tagit kontakt med Mig och frågat om du får kalla mig Svenne eller mitt Sverige för skitland. Vet hut eländiga människa !!!
    Skrivet den juli 25, 2015 kl 14:47 av Carina Engkvist

  6. Vem är du som får göra en så dålig bok som ska ut i vuxenutbildning ? ?
    Jag hoppas verkligen att INGEN vettig SFI lärare använder denna bok.
    Du borde skämmas ! !
    Skrivet den juli 26, 2015 kl 0:08 av Marita

  7. Hej!
    Jag tänkte besöka dig Anders Westerberg, så att du får en chans att förklara dig och dina uttryck om Svenskar och vårt levnadssätt. Förstår inte riktigt hur du tänker när du gjort en bok som utmålar invånarna i Sverige som svaga, rädda,reserverade

    Ta nu chansen att förklara dig innan jag lämnar in en anmälan om ärekränkning, förtal och diskriminering.
    Skrivet den juli 26, 2015 kl 1:27 av Jan Olsson

  8. Halloj. ..

    Nog för att vi svenskar inte är så kristna men vi kristna har väl aldrig bett till gud eller hållit bön på det sättet du valt att illustrera din bok. - Du kanske på ett seriöst sätt skulle understryka att vi är just ett kristet land där vi tillåter andra religiösa åskådning.

    När manuset till Pippi Långsrump görs om och hennes pappa inte kallar sig neggerkung längre så tycker du att det är pedagogisk riktigt att klumpa ihop Svenskar till Svennar. Det är bra att just nyanlända får lära sig det...eller?

    Fast det är klart det är ju ett ganska nytt ord i sammanhanget gissar jag.

    Du får gärna förklara hur du tänkte bär du skrev detta för det kan ju finnas en poäng som invandraren "ser", du själv men inte vi andra Svenskar som bott här länge gör.
    Skrivet den juli 26, 2015 kl 8:46 av Pontus Jansson

  9. Svenne är något som jag alltid har avskytt att bli kallad, och det ska ni lära ut till nyanlända! Hur tänker man eller?

    Gör om gör rätt!
    Skrivet den juli 26, 2015 kl 9:22 av Martin Lööf

  10. Anders du är helt enkelt en rasist...Svenne är ett rasistiskt ord som invandrarna använder och så kommer du din tomte med en bok om svenne ....Hjärndöd eller
    Skrivet den juli 26, 2015 kl 13:15 av Hans Gillberg

  11. Du glömde nämna den LÄTTKRÄNKTA Svennen? ;)
    Skrivet den juli 26, 2015 kl 17:02 av Anton

  12. Skandal! Skäms på dig.
    Skrivet den juli 26, 2015 kl 21:39 av Håkan Johansson

  13. Undrar hur du tänkte när du tex använder ordet svenne, det är precis lika illa som ordet neger och väldigt nervärderande. Kan ju bara gratulera dig och andra som kör på det spåret till att öka på rasismen i vårt land.
    Skrivet den juli 27, 2015 kl 0:39 av Joakim Palmqvist

  14. Varför kränker du mig?
    Att använda ordet svenne är precis lika kränkande att använda orden blatte, neger o s v. Det är rasistiskt och olagligt. Vad fasen är inte det du gör?
    Jag blir så ledsen.
    Jag älskar mitt land Sverige och varför kallar du det skitlandet?
    Skrivet den juli 27, 2015 kl 7:15 av Rolf

  15. Den där boken bör dras in.
    Man skulle väl kunna kalla det för "Hets mot folkgrupp"
    Det är väl nästan så att man kan polisanmäla detta lika väl som all annan rasism.
    Skrivet den juli 27, 2015 kl 8:44 av Christer

  16. Varför anmäler ingen denna bok, hade den handiat om invandrare för oss svenskar hade den redan varit det. Och dessutom stor nyhet i media och SVT.
    Hade jag vetat hur man gör hade jag nog gjort det. Eller är det typiskt Svenskt att bara klaga och knyta handen i fickan.
    Skrivet den juli 27, 2015 kl 9:58 av Rolf

  17. Seriöst borde det inte gå att ta rättsliga aktioner emot författaren och SFI som använder detta som en lärobok?
    Skrivet den juli 27, 2015 kl 10:11 av Simon

  18. Hej!
    Läste just delar av din bok för SFI, och blev väldigt lessen då jag omedelbart såg att du hade använt dig av nidord av folkgrupper. I detta fall var det om svenskarna, men frågan vilken folkgrupp som kommer att utsättas härnäst, judar, muslimer eller afro?

    Visst, ur ett svenskt perspektiv är texten både ironisk och rolog, men humor och ironi är väldigt lokalt förankrat.

    Jag hoppas att du tänker till lite extra när du får ett liknande uppdrag nästa gång, denna ingå var nog inge större sucse för någon berörd ( om man inte räknar med SD....
    Skrivet den juli 27, 2015 kl 12:35 av Stefan Ohlsson

Inlägget är stängt för kommentarer.